Lineage for d1hvf__ (1hvf -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.65: Annexin [47873] (1 superfamily) Superfamily a.65.1: Annexin [47874] (1 family) 
Family a.65.1.1: Annexin [47875] (7 proteins) 
Protein Annexin V [47883] (3 species) Species Human (Homo sapiens) [TaxId:9606] [47885] (10 PDB entries) 
Domain d1hvf__: 1hvf - [18155]
Details for d1hvf__
PDB Entry: 1hvf (more details), 2 Å
PDB Description: structural and electrophysiological analysis of annexin v mutants. mutagenesis of human annexin v, an in vitro voltage-gated calcium channel, provides information about the structural features of the ion pathway, the voltage sensor and the ion selectivity filter
SCOP Domain Sequences for d1hvf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hvf__ a.65.1.1 (-) Annexin V {Human (Homo sapiens)}
vlrgtvtdfpgfdgradaetlrkamkglgtdeesiltlltsrsnaqrqeisaafktlfgr
dllddlkseltgkfqklivalmkpsrlydayelkhalkgagtnekvlteiiasrtpeelr
aikqvyeeeygssleddvvgdtsgyyqrmlvvllqanrdpdagideaqveqdaqalfqag
elkwgtdeekfitifgtrsvshlrkvfdkymtisgfqieetidretsgnleqlllavvks
irsipaylaetlyyamkgagtddhtlirvmvsrseidlfnirkefrknfatslysmikgd
tsgdykkallllc
SCOP Domain Coordinates for d1hvf__:
Click to download the PDB-style file with coordinates for d1hvf__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hvf__:
- d1hvf__ appears in SCOP 1.57
- d1hvf__ appears in the current release, SCOPe 2.08, called d1hvfa_
View in 3D