SCOP 1.65: Domain d1qdmc1: 1qdm C:1S-104S

Lineage for d1qdmc1 (1qdm C:1S-104S)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.64: Saposin-like [47861] (2 superfamilies)
   5 helices; folded leaf, closed

4. Superfamily a.64.1: Saposin [47862] (3 families)
   Lipid-binding can promote conformational changes and oligomerisation in some members

5. Family a.64.1.2: Swaposin [47866] (1 protein)
   circularly permuted saposin domain inserted in plant acid proteases

6. Protein (Pro)phytepsin [47867] (1 species)

7. Species Barley (Hordeum vulgare) [TaxId:4513] [47868] (1 PDB entry)

8. Domain d1qdmc1: 1qdm C:1S-104S [18143]
   Other proteins in same PDB: d1qdma2, d1qdmb2, d1qdmc2

Details for d1qdmc1

PDB Entry: 1qdm, 2.3 Å

PDB Description: crystal structure of prophytepsin, a zymogen of a barley vacuolar aspartic proteinase.

SCOP Domain Sequences for d1qdmc1:

Sequence, based on SEQRES records:

>d1qdmc1 a.64.1.2 (C:1S-104S) (Pro)phytepsin {Barley (Hordeum vulgare)}
vvsqecktivsqygqqildlllaetqpkkicsqvglctfdgtrgvsagirsvvddepvks
nglradpmcsacemavvwmqnqlaqnktqdlildyvnqlcnrlp

Sequence, based on observed residues (ATOM records):

>d1qdmc1 a.64.1.2 (C:1S-104S) (Pro)phytepsin {Barley (Hordeum vulgare)}
vvsqecktivsqygqqildlllaetqpkkicsqvglctadpmcsacemavvwmqnqlaqn
ktqdlildyvnqlcnrlp

Timeline for d1qdmc1:

• d1qdmc1 first appeared (with stable ids) in SCOP 1.55
  
• d1qdmc1 appears in SCOP 1.63
  
• d1qdmc1 appears in SCOP 1.67
  
• d1qdmc1 appears in the current release, SCOPe 2.08