Lineage for d1qdmc1 (1qdm C:1S-104S)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716976Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 2716977Superfamily a.64.1: Saposin [47862] (5 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 2717014Family a.64.1.2: Swaposin [47866] (1 protein)
    circularly permuted saposin domain inserted in plant acid proteases
  6. 2717015Protein (Pro)phytepsin [47867] (1 species)
  7. 2717016Species Barley (Hordeum vulgare) [TaxId:4513] [47868] (1 PDB entry)
  8. 2717019Domain d1qdmc1: 1qdm C:1S-104S [18143]
    Other proteins in same PDB: d1qdma2, d1qdmb2, d1qdmc2

Details for d1qdmc1

PDB Entry: 1qdm (more details), 2.3 Å

PDB Description: crystal structure of prophytepsin, a zymogen of a barley vacuolar aspartic proteinase.
PDB Compounds: (C:) prophytepsin

SCOPe Domain Sequences for d1qdmc1:

Sequence, based on SEQRES records: (download)

>d1qdmc1 a.64.1.2 (C:1S-104S) (Pro)phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]}
vvsqecktivsqygqqildlllaetqpkkicsqvglctfdgtrgvsagirsvvddepvks
nglradpmcsacemavvwmqnqlaqnktqdlildyvnqlcnrlp

Sequence, based on observed residues (ATOM records): (download)

>d1qdmc1 a.64.1.2 (C:1S-104S) (Pro)phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]}
vvsqecktivsqygqqildlllaetqpkkicsqvglctadpmcsacemavvwmqnqlaqn
ktqdlildyvnqlcnrlp

SCOPe Domain Coordinates for d1qdmc1:

Click to download the PDB-style file with coordinates for d1qdmc1.
(The format of our PDB-style files is described here.)

Timeline for d1qdmc1: