Lineage for d1qdma1 (1qdm A:1S-104S)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215048Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 215049Superfamily a.64.1: Saposin [47862] (3 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 215057Family a.64.1.2: Swaposin [47866] (1 protein)
    circularly permuted saposin domain inserted in plant acid proteases
  6. 215058Protein (Pro)phytepsin [47867] (1 species)
  7. 215059Species Barley (Hordeum vulgare) [TaxId:4513] [47868] (1 PDB entry)
  8. 215060Domain d1qdma1: 1qdm A:1S-104S [18141]
    Other proteins in same PDB: d1qdma2, d1qdmb2, d1qdmc2

Details for d1qdma1

PDB Entry: 1qdm (more details), 2.3 Å

PDB Description: crystal structure of prophytepsin, a zymogen of a barley vacuolar aspartic proteinase.

SCOP Domain Sequences for d1qdma1:

Sequence, based on SEQRES records: (download)

>d1qdma1 a.64.1.2 (A:1S-104S) (Pro)phytepsin {Barley (Hordeum vulgare)}
vvsqecktivsqygqqildlllaetqpkkicsqvglctfdgtrgvsagirsvvddepvks
nglradpmcsacemavvwmqnqlaqnktqdlildyvnqlcnrlp

Sequence, based on observed residues (ATOM records): (download)

>d1qdma1 a.64.1.2 (A:1S-104S) (Pro)phytepsin {Barley (Hordeum vulgare)}
vvsqecktivsqygqqildlllaetqpkkicsqvglctadpmcsacemavvwmqnqlaqn
ktqdlildyvnqlcnrlp

SCOP Domain Coordinates for d1qdma1:

Click to download the PDB-style file with coordinates for d1qdma1.
(The format of our PDB-style files is described here.)

Timeline for d1qdma1: