SCOPe 2.08: Domain d1qdma1: 1qdm A:1S-104S

Lineage for d1qdma1 (1qdm A:1S-104S)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.64: Saposin-like [47861] (2 superfamilies)
   5 helices; folded leaf, closed

4. Superfamily a.64.1: Saposin [47862] (5 families)
   Lipid-binding can promote conformational changes and oligomerisation in some members

5. Family a.64.1.2: Swaposin [47866] (1 protein)
   circularly permuted saposin domain inserted in plant acid proteases

6. Protein (Pro)phytepsin [47867] (1 species)

7. Species Barley (Hordeum vulgare) [TaxId:4513] [47868] (1 PDB entry)

8. Domain d1qdma1: 1qdm A:1S-104S [18141]
   Other proteins in same PDB: d1qdma2, d1qdmb2, d1qdmc2

Details for d1qdma1

PDB Entry: 1qdm, 2.3 Å

PDB Description: crystal structure of prophytepsin, a zymogen of a barley vacuolar aspartic proteinase.

PDB Compounds: (A:) prophytepsin

SCOPe Domain Sequences for d1qdma1:

Sequence, based on SEQRES records:

>d1qdma1 a.64.1.2 (A:1S-104S) (Pro)phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]}
vvsqecktivsqygqqildlllaetqpkkicsqvglctfdgtrgvsagirsvvddepvks
nglradpmcsacemavvwmqnqlaqnktqdlildyvnqlcnrlp

Sequence, based on observed residues (ATOM records):

>d1qdma1 a.64.1.2 (A:1S-104S) (Pro)phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]}
vvsqecktivsqygqqildlllaetqpkkicsqvglctadpmcsacemavvwmqnqlaqn
ktqdlildyvnqlcnrlp

Timeline for d1qdma1:

• d1qdma1 first appeared (with stable ids) in SCOP 1.55
  
• d1qdma1 appears in SCOPe 2.07