Lineage for d3mjhc_ (3mjh C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448426Protein Rab5a [82399] (1 species)
  7. 2448427Species Human (Homo sapiens) [TaxId:9606] [82400] (12 PDB entries)
    Uniprot P20339 18-182
  8. 2448438Domain d3mjhc_: 3mjh C: [181299]
    automated match to d1tu4a_
    complexed with gtp, mg, zn

Details for d3mjhc_

PDB Entry: 3mjh (more details), 2.03 Å

PDB Description: Crystal Structure of Human Rab5A in complex with the C2H2 Zinc Finger of EEA1
PDB Compounds: (C:) Ras-related protein Rab-5A

SCOPe Domain Sequences for d3mjhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mjhc_ c.37.1.8 (C:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}
kicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiwdt
agleryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnkad
lankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpk

SCOPe Domain Coordinates for d3mjhc_:

Click to download the PDB-style file with coordinates for d3mjhc_.
(The format of our PDB-style files is described here.)

Timeline for d3mjhc_: