SCOPe 2.08: Domain d3mjhc_: 3mjh C:

Lineage for d3mjhc_ (3mjh C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab5a [82399] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82400] (12 PDB entries)
   Uniprot P20339 18-182

8. Domain d3mjhc_: 3mjh C: [181299]
   automated match to d1tu4a_
   complexed with gtp, mg, zn

Details for d3mjhc_

PDB Entry: 3mjh, 2.03 Å

PDB Description: crystal structure of human rab5a in complex with the c2h2 zinc finger of eea1

PDB Compounds: (C:) Ras-related protein Rab-5A

SCOPe Domain Sequences for d3mjhc_:

Sequence; same for both SEQRES and ATOM records:

>d3mjhc_ c.37.1.8 (C:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}
kicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiwdt
agleryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnkad
lankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpk

Timeline for d3mjhc_:

• d3mjhc_ first appeared in SCOPe 2.01
  
• d3mjhc_ appears in SCOPe 2.07