SCOPe 2.08: Domain d3mjha_: 3mjh A:

Lineage for d3mjha_ (3mjh A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab5a [82399] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82400] (12 PDB entries)
   Uniprot P20339 18-182

8. Domain d3mjha_: 3mjh A: [181298]
   automated match to d1tu4a_
   complexed with gtp, mg, zn

Details for d3mjha_

PDB Entry: 3mjh, 2.03 Å

PDB Description: crystal structure of human rab5a in complex with the c2h2 zinc finger of eea1

PDB Compounds: (A:) Ras-related protein Rab-5A

SCOPe Domain Sequences for d3mjha_:

Sequence; same for both SEQRES and ATOM records:

>d3mjha_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}
nkicqfklvllgesavgksslvlrfvkgqfhefqestigaafltqtvclddttvkfeiwd
tagleryhslapmyyrgaqaaivvyditneesfaraknwvkelqrqaspnivialsgnka
dlankravdfqeaqsyaddnsllfmetsaktsmnvneifmaiakklpk

Timeline for d3mjha_:

• d3mjha_ first appeared in SCOPe 2.01
  
• d3mjha_ appears in SCOPe 2.07