SCOP 1.67: Domain d1a0p_1: 1a0p 3-100

Lineage for d1a0p_1 (1a0p 3-100)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family)

5. Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)

6. Protein Recombinase XerD [47827] (1 species)

7. Species Escherichia coli [TaxId:562] [47828] (1 PDB entry)

8. Domain d1a0p_1: 1a0p 3-100 [18105]
   Other proteins in same PDB: d1a0p_2

Details for d1a0p_1

PDB Entry: 1a0p, 2.5 Å

PDB Description: site-specific recombinase, xerd

SCOP Domain Sequences for d1a0p_1:

Sequence, based on SEQRES records:

>d1a0p_1 a.60.9.1 (3-100) Recombinase XerD {Escherichia coli}
qdlarieqfldalwleknlaentlnayrrdlsmmvewlhhrgltlataqsddlqallaer
leggykatssarllsavrrlfqylyrekfreddpsahl

Sequence, based on observed residues (ATOM records):

>d1a0p_1 a.60.9.1 (3-100) Recombinase XerD {Escherichia coli}
qdlarieqfldalwleknlaentlnayrrdlsmmvewlhhrgltlataqsddlqallaer
lssarllsavrrlfqylyrekfreddpsahl

Timeline for d1a0p_1:

• d1a0p_1 first appeared (with stable ids) in SCOP 1.55
  
• d1a0p_1 appears in SCOP 1.65
  
• d1a0p_1 appears in SCOP 1.69
  
• d1a0p_1 appears in the current release, SCOPe 2.08, called d1a0pa1