Lineage for d1a0pa1 (1a0p A:3-100)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716296Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (2 families) (S)
  5. 2716297Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
  6. 2716362Protein Recombinase XerD [47827] (1 species)
  7. 2716363Species Escherichia coli [TaxId:562] [47828] (1 PDB entry)
  8. 2716364Domain d1a0pa1: 1a0p A:3-100 [18105]
    Other proteins in same PDB: d1a0pa2

Details for d1a0pa1

PDB Entry: 1a0p (more details), 2.5 Å

PDB Description: site-specific recombinase, xerd
PDB Compounds: (A:) site-specific recombinase xerd

SCOPe Domain Sequences for d1a0pa1:

Sequence, based on SEQRES records: (download)

>d1a0pa1 a.60.9.1 (A:3-100) Recombinase XerD {Escherichia coli [TaxId: 562]}
qdlarieqfldalwleknlaentlnayrrdlsmmvewlhhrgltlataqsddlqallaer
leggykatssarllsavrrlfqylyrekfreddpsahl

Sequence, based on observed residues (ATOM records): (download)

>d1a0pa1 a.60.9.1 (A:3-100) Recombinase XerD {Escherichia coli [TaxId: 562]}
qdlarieqfldalwleknlaentlnayrrdlsmmvewlhhrgltlataqsddlqallaer
lssarllsavrrlfqylyrekfreddpsahl

SCOPe Domain Coordinates for d1a0pa1:

Click to download the PDB-style file with coordinates for d1a0pa1.
(The format of our PDB-style files is described here.)

Timeline for d1a0pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a0pa2