PDB entry 1a0p

View 1a0p on RCSB PDB site
Description: site-specific recombinase, xerd
Class: DNA recombination
Keywords: xerd, recombinase, DNA binding, DNA recombination
Deposited on 1997-12-05, released 1998-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: site-specific recombinase xerd
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a0pa1, d1a0pa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a0pA (A:)
    qdlarieqfldalwleknlaentlnayrrdlsmmvewlhhrgltlataqsddlqallaer
    leggykatssarllsavrrlfqylyrekfreddpsahlaspklpqrlpkdlseaqverll
    qaplidqplelrdkamlevlyatglrvselvgltmsdislrqgvvrvigkgnkerlvplg
    eeavywletylehgrpwllngvsidvlfpsqraqqmtrqtfwhrikhyavlagidsekls
    phvlrhafathllnhgadlrvvqmllghsdlsttqiythvaterlrqlhq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a0pA (A:)
    qdlarieqfldalwleknlaentlnayrrdlsmmvewlhhrgltlataqsddlqallaer
    lssarllsavrrlfqylyrekfreddpsahlkdlseaqverllqaplidqplelrdkaml
    evlyatglrvselvgltmsdislrqgvvrvigkgnkerlvplgeeavywletylehgrpw
    llngvsidvlfpsqraqqmtrqtfwhrikhyavlagidseklsphvlrhafathllnhga
    dlrvvqmllsdlsttqiythvaterlrqlhq