Lineage for d1a0p_2 (1a0p 111-292)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 420830Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 420831Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 420832Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)
  6. 420899Protein Recombinase XerD [56357] (1 species)
  7. 420900Species Escherichia coli [TaxId:562] [56358] (1 PDB entry)
  8. 420901Domain d1a0p_2: 1a0p 111-292 [42165]
    Other proteins in same PDB: d1a0p_1

Details for d1a0p_2

PDB Entry: 1a0p (more details), 2.5 Å

PDB Description: site-specific recombinase, xerd

SCOP Domain Sequences for d1a0p_2:

Sequence, based on SEQRES records: (download)

>d1a0p_2 d.163.1.1 (111-292) Recombinase XerD {Escherichia coli}
kdlseaqverllqaplidqplelrdkamlevlyatglrvselvgltmsdislrqgvvrvi
gkgnkerlvplgeeavywletylehgrpwllngvsidvlfpsqraqqmtrqtfwhrikhy
avlagidseklsphvlrhafathllnhgadlrvvqmllghsdlsttqiythvaterlrql
hq

Sequence, based on observed residues (ATOM records): (download)

>d1a0p_2 d.163.1.1 (111-292) Recombinase XerD {Escherichia coli}
kdlseaqverllqaplidqplelrdkamlevlyatglrvselvgltmsdislrqgvvrvi
gkgnkerlvplgeeavywletylehgrpwllngvsidvlfpsqraqqmtrqtfwhrikhy
avlagidseklsphvlrhafathllnhgadlrvvqmllsdlsttqiythvaterlrqlhq

SCOP Domain Coordinates for d1a0p_2:

Click to download the PDB-style file with coordinates for d1a0p_2.
(The format of our PDB-style files is described here.)

Timeline for d1a0p_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a0p_1