Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.6: Leukocidin-like [56958] (1 superfamily) subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel |
Superfamily f.6.1: Leukocidin-like [56959] (2 families) |
Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins) heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit |
Protein Alpha-hemolysin [56961] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [56962] (5 PDB entries) |
Domain d3m4ed_: 3m4e D: [180838] automated match to d7ahla_ complexed with bcd; mutant |
PDB Entry: 3m4e (more details), 2.3 Å
SCOPe Domain Sequences for d3m4ed_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m4ed_ f.6.1.1 (D:) Alpha-hemolysin {Staphylococcus aureus [TaxId: 1280]} adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeynstltygf ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn
Timeline for d3m4ed_: