Lineage for d3m4eg_ (3m4e G:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1058516Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 1058517Superfamily f.6.1: Leukocidin-like [56959] (2 families) (S)
  5. 1058518Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
    heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
  6. 1058519Protein Alpha-hemolysin [56961] (1 species)
  7. 1058520Species Staphylococcus aureus [TaxId:1280] [56962] (5 PDB entries)
  8. 1058555Domain d3m4eg_: 3m4e G: [180841]
    automated match to d7ahla_
    complexed with bcd; mutant

Details for d3m4eg_

PDB Entry: 3m4e (more details), 2.3 Å

PDB Description: crystal structure of the m113n mutant of alpha-hemolysin bound to beta-cyclodextrin
PDB Compounds: (G:) alpha-hemolysin

SCOPe Domain Sequences for d3m4eg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m4eg_ f.6.1.1 (G:) Alpha-hemolysin {Staphylococcus aureus [TaxId: 1280]}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeynstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

SCOPe Domain Coordinates for d3m4eg_:

Click to download the PDB-style file with coordinates for d3m4eg_.
(The format of our PDB-style files is described here.)

Timeline for d3m4eg_: