Lineage for d3m4ed_ (3m4e D:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022603Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (greek-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 3022604Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 3022605Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
    heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
    automatically mapped to Pfam PF07968
  6. 3022606Protein Alpha-hemolysin [56961] (2 species)
  7. 3022607Species Staphylococcus aureus [TaxId:1280] [56962] (9 PDB entries)
  8. 3022639Domain d3m4ed_: 3m4e D: [180838]
    automated match to d7ahla_
    mutant

Details for d3m4ed_

PDB Entry: 3m4e (more details), 2.3 Å

PDB Description: crystal structure of the m113n mutant of alpha-hemolysin bound to beta-cyclodextrin
PDB Compounds: (D:) alpha-hemolysin

SCOPe Domain Sequences for d3m4ed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m4ed_ f.6.1.1 (D:) Alpha-hemolysin {Staphylococcus aureus [TaxId: 1280]}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeynstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

SCOPe Domain Coordinates for d3m4ed_:

Click to download the PDB-style file with coordinates for d3m4ed_.
(The format of our PDB-style files is described here.)

Timeline for d3m4ed_: