![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.9: RNA polymerase subunits [63393] (3 families) ![]() |
![]() | Family g.41.9.0: automated matches [191622] (1 protein) not a true family |
![]() | Protein automated matches [191140] (5 species) not a true protein |
![]() | Species Methanocaldococcus jannaschii [TaxId:2190] [189266] (1 PDB entry) |
![]() | Domain d3lpeb_: 3lpe B: [180495] automated match to d1ryqa_ protein/DNA complex; protein/RNA complex; complexed with zn |
PDB Entry: 3lpe (more details), 1.9 Å
SCOPe Domain Sequences for d3lpeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lpeb_ g.41.9.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]} mraclkckyltndeicpichsptsenwigllivinpekseiakkagidikgkyalsvke
Timeline for d3lpeb_: