SCOPe 2.08: Domain d3lpeh_: 3lpe H:

Lineage for d3lpeh_ (3lpe H:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.9: RNA polymerase subunits [63393] (3 families)

5. Family g.41.9.0: automated matches [191622] (1 protein)
   not a true family

6. Protein automated matches [191140] (5 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:2190] [189266] (1 PDB entry)

8. Domain d3lpeh_: 3lpe H: [180498]
   automated match to d1ryqa_
   protein/DNA complex; protein/RNA complex; complexed with zn

Details for d3lpeh_

PDB Entry: 3lpe, 1.9 Å

PDB Description: crystal structure of spt4/5ngn heterodimer complex from methanococcus jannaschii

PDB Compounds: (H:) DNA-directed RNA polymerase subunit E''

SCOPe Domain Sequences for d3lpeh_:

Sequence; same for both SEQRES and ATOM records:

>d3lpeh_ g.41.9.0 (H:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mraclkckyltndeicpichsptsenwigllivinpekseiakkagidikgkyalsvke

Timeline for d3lpeh_:

• d3lpeh_ first appeared in SCOPe 2.01
  
• d3lpeh_ appears in SCOPe 2.07