SCOPe 2.04: Domain d3ljaa_: 3lja A:

Lineage for d3ljaa_ (3lja A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H3 [47122] (6 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries)

8. Domain d3ljaa_: 3lja A: [180318]
   Other proteins in same PDB: d3ljab_, d3ljad_, d3ljaf_, d3ljah_
   automated match to d1kx5a_
   protein/DNA complex; complexed with mn, so4

Details for d3ljaa_

PDB Entry: 3lja, 2.75 Å

PDB Description: Using Soft X-Rays for a Detailed Picture of Divalent Metal Binding in the Nucleosome

PDB Compounds: (A:) Histone H3.2

SCOPe Domain Sequences for d3ljaa_:

Sequence; same for both SEQRES and ATOM records:

>d3ljaa_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
eaylvalfedtnlcaihakrvtimpkdiqlarrirgera

Timeline for d3ljaa_:

• d3ljaa_ first appeared in SCOPe 2.01
  
• d3ljaa_ appears in SCOPe 2.03
  
• d3ljaa_ appears in SCOPe 2.05
  
• d3ljaa_ appears in the current release, SCOPe 2.08