Lineage for d3ljaa_ (3lja A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725671Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1725672Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1725673Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1725867Protein Histone H3 [47122] (6 species)
  7. 1725868Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries)
  8. 1725936Domain d3ljaa_: 3lja A: [180318]
    Other proteins in same PDB: d3ljab_, d3ljad_, d3ljaf_, d3ljah_
    automated match to d1kx5a_
    protein/DNA complex; complexed with mn, so4

Details for d3ljaa_

PDB Entry: 3lja (more details), 2.75 Å

PDB Description: Using Soft X-Rays for a Detailed Picture of Divalent Metal Binding in the Nucleosome
PDB Compounds: (A:) Histone H3.2

SCOPe Domain Sequences for d3ljaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ljaa_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
eaylvalfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d3ljaa_:

Click to download the PDB-style file with coordinates for d3ljaa_.
(The format of our PDB-style files is described here.)

Timeline for d3ljaa_: