SCOPe 2.08: Domain d3l71f_: 3l71 F:

Lineage for d3l71f_ (3l71 F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex
   automatically mapped to Pfam PF02271

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein automated matches [190325] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [189228] (8 PDB entries)

8. Domain d3l71f_: 3l71 F: [180017]
   Other proteins in same PDB: d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71c2, d3l71d1, d3l71d2, d3l71e1, d3l71e2, d3l71g_, d3l71h_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71p2, d3l71q1, d3l71q2, d3l71r1, d3l71r2, d3l71t_, d3l71u_, d3l71w_
   automated match to d1sqpf1
   complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq

Details for d3l71f_

PDB Entry: 3l71, 2.84 Å

PDB Description: cytochrome bc1 complex from chicken with azoxystrobin bound

PDB Compounds: (F:) Mitochondrial ubiquinol-cytochrome c reductase 14 kda protein

SCOPe Domain Sequences for d3l71f_:

Sequence; same for both SEQRES and ATOM records:

>d3l71f_ f.27.1.1 (F:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
grlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermfrikraldls
lkhrilpkeqwvkyeedkpylepylkevirerlereawnkk

Timeline for d3l71f_:

• d3l71f_ first appeared in SCOPe 2.01
  
• d3l71f_ appears in SCOPe 2.07