Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) |
Family f.23.12.0: automated matches [254198] (1 protein) not a true family |
Protein automated matches [254432] (4 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [260678] (8 PDB entries) |
Domain d3l71r1: 3l71 R:1-69 [262295] Other proteins in same PDB: d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71c2, d3l71d1, d3l71d2, d3l71e2, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71p2, d3l71q1, d3l71q2, d3l71r2, d3l71s_, d3l71t_, d3l71u_, d3l71w_ automated match to d3l70e1 complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq |
PDB Entry: 3l71 (more details), 2.84 Å
SCOPe Domain Sequences for d3l71r1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l71r1 f.23.12.0 (R:1-69) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} vhndvtvpdfsayrredvmdattssqtssedrkgfsylvtatacvatayaaknvvtqfis slsasadvl
Timeline for d3l71r1:
View in 3D Domains from other chains: (mouse over for more information) d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71c2, d3l71d1, d3l71d2, d3l71e1, d3l71e2, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71p2, d3l71q1, d3l71q2, d3l71s_, d3l71t_, d3l71u_, d3l71w_ |