Lineage for d3l71d2 (3l71 D:196-241)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578712Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) (S)
  5. 2578753Family f.23.11.0: automated matches [232790] (1 protein)
    not a true family
  6. 2578754Protein automated matches [232791] (3 species)
    not a true protein
  7. 2578757Species Chicken (Gallus gallus) [TaxId:9031] [232792] (8 PDB entries)
  8. 2578764Domain d3l71d2: 3l71 D:196-241 [343837]
    Other proteins in same PDB: d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71c2, d3l71d1, d3l71e1, d3l71e2, d3l71f_, d3l71g_, d3l71h_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71p2, d3l71q1, d3l71r1, d3l71r2, d3l71s_, d3l71t_, d3l71u_, d3l71w_
    complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq

Details for d3l71d2

PDB Entry: 3l71 (more details), 2.84 Å

PDB Description: cytochrome bc1 complex from chicken with azoxystrobin bound
PDB Compounds: (D:) Mitochondrial cytochrome c1, heme protein

SCOPe Domain Sequences for d3l71d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l71d2 f.23.11.0 (D:196-241) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
pehdqrkrmglkmllisalltsllyymkrhkwsvlksrkmayrppk

SCOPe Domain Coordinates for d3l71d2:

Click to download the PDB-style file with coordinates for d3l71d2.
(The format of our PDB-style files is described here.)

Timeline for d3l71d2:

  • d3l71d2 is new in SCOPe 2.07-stable