Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Trypsin(ogen) [50515] (9 species) |
Species Human (Homo sapiens), trypsin IV (brain isoform) [TaxId:9606] [69283] (15 PDB entries) |
Domain d3l3td_: 3l3t D: [179918] Other proteins in same PDB: d3l3te_, d3l3tf_, d3l3tg_, d3l3th_ automated match to d1h4wa_ complexed with ca, fmt |
PDB Entry: 3l3t (more details), 2.38 Å
SCOPe Domain Sequences for d3l3td_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l3td_ b.47.1.2 (D:) Trypsin(ogen) {Human (Homo sapiens), trypsin IV (brain isoform) [TaxId: 9606]} ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
Timeline for d3l3td_: