Lineage for d3l3tf_ (3l3t F:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637270Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2637271Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2637272Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2637462Protein automated matches [190046] (3 species)
    not a true protein
  7. 2637507Species Human (Homo sapiens) [TaxId:9606] [186911] (9 PDB entries)
  8. 2637511Domain d3l3tf_: 3l3t F: [179920]
    Other proteins in same PDB: d3l3ta_, d3l3tb_, d3l3tc_, d3l3td_
    automated match to d1aapa_
    complexed with ca, fmt

Details for d3l3tf_

PDB Entry: 3l3t (more details), 2.38 Å

PDB Description: Human mesotrypsin complexed with amyloid precursor protein inhibitor variant (APPIR15K)
PDB Compounds: (F:) Protein APP

SCOPe Domain Sequences for d3l3tf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l3tf_ g.8.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evcseqaetgpckamisrwyfdvtegkcapffyggcggnrnnfdteeycmavcgsai

SCOPe Domain Coordinates for d3l3tf_:

Click to download the PDB-style file with coordinates for d3l3tf_.
(The format of our PDB-style files is described here.)

Timeline for d3l3tf_: