SCOPe 2.08: Domain d3kzaa_: 3kza A:

Lineage for d3kzaa_ (3kza A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (13 species)
   not a true protein

7. Species Horse (Equus caballus) [TaxId:9796] [189576] (1 PDB entry)

8. Domain d3kzaa_: 3kza A: [179826]
   automated match to d1yupa1

Details for d3kzaa_

PDB Entry: 3kza, 2 Å

PDB Description: crystal structure of gyuba, a patched chimera of b-lactglobulin

PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d3kzaa_:

Sequence, based on SEQRES records:

>d3kzaa_ b.60.1.1 (A:) automated matches {Horse (Equus caballus) [TaxId: 9796]}
ipqtmqdldlqevagtwyslamaasdislldsesaplrvyveelkptpegdleillqkwe
nkgcaqkkiiaektespaefkidaldenkvlvldtdyknyllfcmenaatpgqslacqal
vrtqmvddealekfdkalqplpmhirlsfnptrma

Sequence, based on observed residues (ATOM records):

>d3kzaa_ b.60.1.1 (A:) automated matches {Horse (Equus caballus) [TaxId: 9796]}
ipqtmqdldlqevagtwyslamaasdislldsesaplrvyveelkptpegdleillqkaq
kkiiaektespaefkidaldenkvlvldtdyknyllfcmenaatpgqslacqalvrtqmv
ddealekfdkalqplpmhirlsfnptrma

Timeline for d3kzaa_:

• d3kzaa_ first appeared in SCOPe 2.01
  
• d3kzaa_ appears in SCOPe 2.07