SCOPe 2.08: Domain d1cooa_: 1coo A:

Lineage for d1cooa_ (1coo A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins)

6. Protein C-terminal domain of RNA polymerase alpha subunit [47791] (4 species)

7. Species Escherichia coli [TaxId:562] [47792] (2 PDB entries)

8. Domain d1cooa_: 1coo A: [17967]

Details for d1cooa_

PDB Entry: 1coo

PDB Description: the cooh-terminal domain of rna polymerase alpha subunit

PDB Compounds: (A:) RNA polymerase alpha subunit

SCOPe Domain Sequences for d1cooa_:

Sequence; same for both SEQRES and ATOM records:

>d1cooa_ a.60.3.1 (A:) C-terminal domain of RNA polymerase alpha subunit {Escherichia coli [TaxId: 562]}
fdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvla
srglslgmrlenwppasiade

Timeline for d1cooa_:

• d1cooa_ first appeared (with stable ids) in SCOP 1.55, called d1coo__
  
• d1cooa_ appears in SCOPe 2.07