| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins) |
| Protein C-terminal domain of RNA polymerase alpha subunit [47791] (4 species) |
| Species Escherichia coli [TaxId:562] [47792] (2 PDB entries) |
| Domain d1cooa_: 1coo A: [17967] |
PDB Entry: 1coo (more details)
SCOPe Domain Sequences for d1cooa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cooa_ a.60.3.1 (A:) C-terminal domain of RNA polymerase alpha subunit {Escherichia coli [TaxId: 562]}
fdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvla
srglslgmrlenwppasiade
Timeline for d1cooa_: