PDB entry 1coo

View 1coo on RCSB PDB site
Description: the cooh-terminal domain of RNA polymerase alpha subunit
Class: nucleotidyl transferase
Keywords: transcription regulation, nucleotidyl transferase
Deposited on 1995-10-09, released 1996-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA polymerase alpha subunit
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1cooa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1cooA (A:)
mdlrdvrepevkeekpefdpillrpvddleltvrsanclkaeaihyigdlvqrtevellk
tpnlgkkslteikdvlasrglslgmrlenwppasiade

    Sequence, based on observed residues (ATOM records): (download) 
    >1cooA (A:)
fdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvla
srglslgmrlenwppasiade