Class a: All alpha proteins [46456] (202 folds) |
Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.2: RuvA domain 2-like [47781] (3 families) duplication: contains two helix-hairpin-helix (HhH) motifs |
Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein) |
Protein DNA helicase RuvA subunit, middle domain [47783] (3 species) tetramer; binds Holliday junction |
Species Mycobacterium leprae [TaxId:1769] [47785] (1 PDB entry) |
Domain d1bvsc2: 1bvs C:64-134 [17957] Other proteins in same PDB: d1bvsa1, d1bvsa3, d1bvsb1, d1bvsb3, d1bvsc1, d1bvsc3, d1bvsd1, d1bvsd3, d1bvse1, d1bvse3, d1bvsf1, d1bvsf3, d1bvsg1, d1bvsg3, d1bvsh1, d1bvsh3 |
PDB Entry: 1bvs (more details), 3 Å
SCOP Domain Sequences for d1bvsc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvsc2 a.60.2.1 (C:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae} daenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrgaeri vleladkvgpv
Timeline for d1bvsc2: