SCOP 1.67: Domain d1bvse3: 1bvs E:1-63

Lineage for d1bvse3 (1bvs E:1-63)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families)

5. Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein)
   barrel, closed; n=5, S=10

6. Protein DNA helicase RuvA subunit, N-terminal domain [50260] (3 species)
   tetramer; binds Holliday junction

7. Species Mycobacterium leprae [TaxId:1769] [50262] (1 PDB entry)

8. Domain d1bvse3: 1bvs E:1-63 [25278]
   Other proteins in same PDB: d1bvsa1, d1bvsa2, d1bvsb1, d1bvsb2, d1bvsc1, d1bvsc2, d1bvsd1, d1bvsd2, d1bvse1, d1bvse2, d1bvsf1, d1bvsf2, d1bvsg1, d1bvsg2, d1bvsh1, d1bvsh2

Details for d1bvse3

PDB Entry: 1bvs, 3 Å

PDB Description: ruva complexed to a holliday junction.

SCOP Domain Sequences for d1bvse3:

Sequence; same for both SEQRES and ATOM records:

>d1bvse3 b.40.4.2 (E:1-63) DNA helicase RuvA subunit, N-terminal domain {Mycobacterium leprae}
mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
gfs

Timeline for d1bvse3:

• d1bvse3 first appeared (with stable ids) in SCOP 1.55
  
• d1bvse3 appears in SCOP 1.65
  
• d1bvse3 appears in SCOP 1.69
  
• d1bvse3 appears in the current release, SCOPe 2.08