Lineage for d1bvsc2 (1bvs C:64-134)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 444234Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 444306Superfamily a.60.2: RuvA domain 2-like [47781] (3 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 444307Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein)
  6. 444308Protein DNA helicase RuvA subunit, middle domain [47783] (3 species)
    tetramer; binds Holliday junction
  7. 444319Species Mycobacterium leprae [TaxId:1769] [47785] (1 PDB entry)
  8. 444322Domain d1bvsc2: 1bvs C:64-134 [17957]
    Other proteins in same PDB: d1bvsa1, d1bvsa3, d1bvsb1, d1bvsb3, d1bvsc1, d1bvsc3, d1bvsd1, d1bvsd3, d1bvse1, d1bvse3, d1bvsf1, d1bvsf3, d1bvsg1, d1bvsg3, d1bvsh1, d1bvsh3

Details for d1bvsc2

PDB Entry: 1bvs (more details), 3 Å

PDB Description: ruva complexed to a holliday junction.

SCOP Domain Sequences for d1bvsc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvsc2 a.60.2.1 (C:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae}
daenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrgaeri
vleladkvgpv

SCOP Domain Coordinates for d1bvsc2:

Click to download the PDB-style file with coordinates for d1bvsc2.
(The format of our PDB-style files is described here.)

Timeline for d1bvsc2: