Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.0: automated matches [191603] (1 protein) not a true family |
Protein automated matches [191100] (15 species) not a true protein |
Species Methanocaldococcus jannaschii [TaxId:2190] [189191] (3 PDB entries) |
Domain d3kpdc_: 3kpd C: [179522] automated match to d2ef7a1 complexed with mta, sam |
PDB Entry: 3kpd (more details), 2.91 Å
SCOPe Domain Sequences for d3kpdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kpdc_ d.37.1.0 (C:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]} tlvkdilskppitahsnisimeaakilikhninhlpivdehgklvgiitswdiakalaqn kktieeimtrnvitahedepvdhvaikmskynisgvpvvddyrrvvgivtsedisrlfg
Timeline for d3kpdc_: