Lineage for d2ef7a1 (2ef7 A:1-127)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.37: CBS-domain pair [54630] (1 superfamily)
duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/aSuperfamily d.37.1: CBS-domain pair [54631] (2 families) 
Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
Protein Uncharacterized protein ST2348 [160161] (1 species) Species Sulfolobus tokodaii [TaxId:111955] [160162] (1 PDB entry)
Uniprot Q96Y20 1-127
Domain d2ef7a1: 2ef7 A:1-127 [146810]
Other proteins in same PDB: d2ef7b_
Details for d2ef7a1
PDB Entry: 2ef7 (more details), 2.1 Å
PDB Description: Crystal structure of ST2348, a hypothetical protein with CBS domains from Sulfolobus tokodaii strain7
PDB Compounds: (A:) Hypothetical protein ST2348SCOPe Domain Sequences for d2ef7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]}
meeeivkeymktqvisvtkdaklndiakvmteknigsvivvdgnkpvgiiterdivkaig
kgksletkaeefmtaslitiredspitgalalmrqfnirhlpvvddkgnlkgiisirdit
raiddmf
SCOPe Domain Coordinates for d2ef7a1:
Click to download the PDB-style file with coordinates for d2ef7a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ef7a1:
- d2ef7a1 first appeared in SCOP 1.75
- d2ef7a1 appears in SCOPe 2.07
View in 3D
