SCOPe 2.08: Domain d3khba_: 3khb A:

Lineage for d3khba_ (3khb A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.10: AlkB-like [141628] (3 proteins)
   automatically mapped to Pfam PF13532

6. Protein automated matches [191077] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189001] (20 PDB entries)

8. Domain d3khba_: 3khb A: [179368]
   automated match to d2fd8a1
   complexed with akg, co

Details for d3khba_

PDB Entry: 3khb, 2.9 Å

PDB Description: Crystal structure of Escherichia coli AlkB with Co(II) and 2-OG

PDB Compounds: (A:) Alpha-ketoglutarate-dependent dioxygenase AlkB

SCOPe Domain Sequences for d3khba_:

Sequence; same for both SEQRES and ATOM records:

>d3khba_ b.82.2.10 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
qeplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtt
hrqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslh
qdkdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqp
lkagfhpltidcrynltfrqagk

Timeline for d3khba_:

• d3khba_ first appeared in SCOPe 2.01
  
• d3khba_ appears in SCOPe 2.07