SCOPe 2.01: Domain d3kfga_: 3kfg A:

Lineage for d3kfga_ (3kfg A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188249] (7 PDB entries)

8. Domain d3kfga_: 3kfg A: [179332]
   automated match to d1df3a_
   complexed with 2eh, cl, htx

Details for d3kfga_

PDB Entry: 3kfg, 1.43 Å

PDB Description: major mouse urinary protein iv complexed with 2-heptanone

PDB Compounds: (A:) Major urinary protein 4

SCOPe Domain Sequences for d3kfga_:

Sequence; same for both SEQRES and ATOM records:

>d3kfga_ b.60.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lnvekingewfsillasdkrekieehgsmrvfvehihvlenslafkfhtvidgecseifl
vadktekageysvmydgfntftilktdydnyimfhlinekdgktfqlmelygrkadlnsd
ikekfvklceehgiikeniidltktnrclkar

Timeline for d3kfga_:

• d3kfga_ is new in SCOPe 2.01-stable
  
• d3kfga_ appears in SCOPe 2.02
  
• d3kfga_ appears in the current release, SCOPe 2.08