Lineage for d1df3a_ (1df3 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957981Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 957982Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 957983Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 958088Protein Major urinary protein/alpha-2u-globulin [50832] (2 species)
  7. 958089Species Mouse (Mus musculus) [TaxId:10090] [50833] (19 PDB entries)
  8. 958108Domain d1df3a_: 1df3 A: [27134]

Details for d1df3a_

PDB Entry: 1df3 (more details)

PDB Description: solution structure of a recombinant mouse major urinary protein
PDB Compounds: (A:) major urinary protein

SCOPe Domain Sequences for d1df3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1df3a_ b.60.1.1 (A:) Major urinary protein/alpha-2u-globulin {Mouse (Mus musculus) [TaxId: 10090]}
eeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvlekslvlkfhtvr
deecselsmvadktekageysvtydgfntftipktdydnflmahlinekdgetfqlmgly
grepdlssdikerfaqlceehgilreniidlsnanrclqare

SCOPe Domain Coordinates for d1df3a_:

Click to download the PDB-style file with coordinates for d1df3a_.
(The format of our PDB-style files is described here.)

Timeline for d1df3a_: