Lineage for d1ffud1 (1ffu D:82-157)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715250Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2715251Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2715252Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 2715275Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (3 species)
  7. 2715276Species Hydrogenophaga pseudoflava [TaxId:47421] [47750] (2 PDB entries)
  8. 2715280Domain d1ffud1: 1ffu D:82-157 [17918]
    Other proteins in same PDB: d1ffua2, d1ffub1, d1ffub2, d1ffuc1, d1ffuc2, d1ffud2, d1ffue1, d1ffue2, d1ffuf1, d1ffuf2
    complexed with cdp, fad, fes

Details for d1ffud1

PDB Entry: 1ffu (more details), 2.35 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor
PDB Compounds: (D:) cuts, iron-sulfur protein of carbon monoxide dehydrogenase

SCOPe Domain Sequences for d1ffud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffud1 a.56.1.1 (D:82-157) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Hydrogenophaga pseudoflava [TaxId: 47421]}
nkgvlhavqegfykehglqcgfctpgmlmrayrflqenpnpteaeirmgmtgnlcrctgy
qnivkavqyaarklqe

SCOPe Domain Coordinates for d1ffud1:

Click to download the PDB-style file with coordinates for d1ffud1.
(The format of our PDB-style files is described here.)

Timeline for d1ffud1: