PDB entry 1ffu

View 1ffu on RCSB PDB site
Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor
Class: hydrolase
Keywords: hydrolase, dehydrogenase
Deposited on 2000-07-26, released 2000-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.208
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cuts, iron-sulfur protein of carbon monoxide dehydrogenase
    Species: Hydrogenophaga pseudoflava [TaxId:47421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19915
      • conflict (89)
    Domains in SCOPe 2.07: d1ffua1, d1ffua2
  • Chain 'B':
    Compound: cutl, molybdoprotein of carbon monoxide dehydrogenase
    Species: Hydrogenophaga pseudoflava [TaxId:47421]
    Database cross-references and differences (RAF-indexed):
    • GB AAD00363 (Start-802)
      • conflict (18-23)
      • modified (383-384)
      • conflict (455)
    Domains in SCOPe 2.07: d1ffub1, d1ffub2
  • Chain 'C':
    Compound: cutm, flavoprotein of carbon monoxide dehydrogenase
    Species: Hydrogenophaga pseudoflava [TaxId:47421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19914 (0-286)
      • conflict (119)
      • conflict (176)
      • conflict (206)
      • conflict (225)
      • conflict (227-231)
    Domains in SCOPe 2.07: d1ffuc1, d1ffuc2
  • Chain 'D':
    Compound: cuts, iron-sulfur protein of carbon monoxide dehydrogenase
    Species: Hydrogenophaga pseudoflava [TaxId:47421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19915
      • conflict (89)
    Domains in SCOPe 2.07: d1ffud1, d1ffud2
  • Chain 'E':
    Compound: cutl, molybdoprotein of carbon monoxide dehydrogenase
    Species: Hydrogenophaga pseudoflava [TaxId:47421]
    Database cross-references and differences (RAF-indexed):
    • GB AAD00363 (Start-802)
      • conflict (18-23)
      • modified (383-384)
      • conflict (455)
    Domains in SCOPe 2.07: d1ffue1, d1ffue2
  • Chain 'F':
    Compound: cutm, flavoprotein of carbon monoxide dehydrogenase
    Species: Hydrogenophaga pseudoflava [TaxId:47421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19914 (0-286)
      • conflict (119)
      • conflict (176)
      • conflict (206)
      • conflict (225)
      • conflict (227-231)
    Domains in SCOPe 2.07: d1ffuf1, d1ffuf2
  • Heterogens: FES, CDP, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ffuA (A:)
    makkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvk
    scthlavqcdgsevltveglankgvlhavqegfykehglqcgfctpgmlmrayrflqenp
    npteaeirmgmtgnlcrctgyqnivkavqyaarklqepstaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffuA (A:)
    kkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvksc
    thlavqcdgsevltveglankgvlhavqegfykehglqcgfctpgmlmrayrflqenpnp
    teaeirmgmtgnlcrctgyqnivkavqyaarklqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ffuB (B:)
    mnapvqdaearelalagmgasrlrkedarfiqgkgnyvddikmpgmlhmdivrapiahgr
    ikkihkdaalampgvhavltaedlkplklhwmptlagdvaavladekvhfqmqevaivia
    ddryiaadaveavkveydelpvvidpidalkpdapvlredlagktsgahgprehhnhift
    wgagdkaatdavfanapvtvsqhmyyprvhpcpletcgcvasfdpikgdlttyitsqaph
    vvrtvvsmlsgipeskvrivspdigggfgnkvgiypgyvcaivasivlgrpvkwvedrve
    nisttafardyhmdgelaatpdgkilglrvnvvadhgafdacadptkfpaglfhicsgsy
    diprahcsvkgvytnkapggvayrcsfrvteavyliermvdvlaqklnmdkaeiraknfi
    rkeqfpyttqfgfeydsgdyhtalkkvldavdypalraeqaarradpnsptlmgiglvtf
    tevvgagpskmcdilgvgmfdsceirihptgsaiarmgtitqgqghqttyaqiiatelgi
    pseviqveegdtstapyglgtygsrstpvagaaialaarkihakarkiaahmlevnendl
    dwevdrfkvkgddskfktmadiawqayhqppaglepgleavhyydppnftypfgiylcvv
    didratgetkvrrfyalddcgtrinpmiiegqihggltegyavamgqqmpfdaqgnllgn
    tlmdyflptavetphwetdhtvtpsphhpigakgvaesphvgsiptftaavvdafahvgv
    thldmphtsyrvwkslkehnlal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffuB (B:)
    daearelalagmgasrlrkedarfiqgkgnyvddikmpgmlhmdivrapiahgrikkihk
    daalampgvhavltaedlkplklhwmptlagdvaavladekvhfqmqevaiviaddryia
    adaveavkveydelpvvidpidalkpdapvlredlagktsgahgprehhnhiftwgagdk
    aatdavfanapvtvsqhmyyprvhpcpletcgcvasfdpikgdlttyitsqaphvvrtvv
    smlsgipeskvrivspdigggfgnkvgiypgyvcaivasivlgrpvkwvedrvenistta
    fardyhmdgelaatpdgkilglrvnvvadhgafdacadptkfpaglfhicsgsydiprah
    csvkgvytnkapggvayrcsfrvteavyliermvdvlaqklnmdkaeiraknfirkeqfp
    yttqfgfeydsgdyhtalkkvldavdypalraeqaarradpnsptlmgiglvtftevvga
    gpskmcdilgvgmfdsceirihptgsaiarmgtitqgqghqttyaqiiatelgipseviq
    veegdtstapyglgtygsrstpvagaaialaarkihakarkiaahmlevnendldwevdr
    fkvkgddskfktmadiawqayhqppaglepgleavhyydppnftypfgiylcvvdidrat
    getkvrrfyalddcgtrinpmiiegqihggltegyavamgqqmpfdaqgnllgntlmdyf
    lptavetphwetdhtvtpsphhpigakgvaesphvgsiptftaavvdafahvgvthldmp
    htsyrvwkslkehnlal
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffuC (C:)
    mipprfeyhapksvgeavallgqlgsdakllagghsllpmmklrfaqpehlidinripel
    rgireegstvvigamtvendlisspivqarlpllaeaakliadpqvrnrgtiggdiahgd
    pgndhpalsiaveahfvlegpngrrtvpadgfflgtymtlleenevmveirvpafaagtg
    wayeklkrktgdwatagcavvmrksggtvshirialtnvaptalraeaaeaallgkaftk
    eavqaaadaaiaicepaedlrgdadyktamagqmvkralnaawarca
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ffuD (D:)
    makkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvk
    scthlavqcdgsevltveglankgvlhavqegfykehglqcgfctpgmlmrayrflqenp
    npteaeirmgmtgnlcrctgyqnivkavqyaarklqepstaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffuD (D:)
    akkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvks
    cthlavqcdgsevltveglankgvlhavqegfykehglqcgfctpgmlmrayrflqenpn
    pteaeirmgmtgnlcrctgyqnivkavqyaarklqe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ffuE (E:)
    mnapvqdaearelalagmgasrlrkedarfiqgkgnyvddikmpgmlhmdivrapiahgr
    ikkihkdaalampgvhavltaedlkplklhwmptlagdvaavladekvhfqmqevaivia
    ddryiaadaveavkveydelpvvidpidalkpdapvlredlagktsgahgprehhnhift
    wgagdkaatdavfanapvtvsqhmyyprvhpcpletcgcvasfdpikgdlttyitsqaph
    vvrtvvsmlsgipeskvrivspdigggfgnkvgiypgyvcaivasivlgrpvkwvedrve
    nisttafardyhmdgelaatpdgkilglrvnvvadhgafdacadptkfpaglfhicsgsy
    diprahcsvkgvytnkapggvayrcsfrvteavyliermvdvlaqklnmdkaeiraknfi
    rkeqfpyttqfgfeydsgdyhtalkkvldavdypalraeqaarradpnsptlmgiglvtf
    tevvgagpskmcdilgvgmfdsceirihptgsaiarmgtitqgqghqttyaqiiatelgi
    pseviqveegdtstapyglgtygsrstpvagaaialaarkihakarkiaahmlevnendl
    dwevdrfkvkgddskfktmadiawqayhqppaglepgleavhyydppnftypfgiylcvv
    didratgetkvrrfyalddcgtrinpmiiegqihggltegyavamgqqmpfdaqgnllgn
    tlmdyflptavetphwetdhtvtpsphhpigakgvaesphvgsiptftaavvdafahvgv
    thldmphtsyrvwkslkehnlal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ffuE (E:)
    daearelalagmgasrlrkedarfiqgkgnyvddikmpgmlhmdivrapiahgrikkihk
    daalampgvhavltaedlkplklhwmptlagdvaavladekvhfqmqevaiviaddryia
    adaveavkveydelpvvidpidalkpdapvlredlagktsgahgprehhnhiftwgagdk
    aatdavfanapvtvsqhmyyprvhpcpletcgcvasfdpikgdlttyitsqaphvvrtvv
    smlsgipeskvrivspdigggfgnkvgiypgyvcaivasivlgrpvkwvedrvenistta
    fardyhmdgelaatpdgkilglrvnvvadhgafdacadptkfpaglfhicsgsydiprah
    csvkgvytnkapggvayrcsfrvteavyliermvdvlaqklnmdkaeiraknfirkeqfp
    yttqfgfeydsgdyhtalkkvldavdypalraeqaarradpnsptlmgiglvtftevvga
    gpskmcdilgvgmfdsceirihptgsaiarmgtitqgqghqttyaqiiatelgipseviq
    veegdtstapyglgtygsrstpvagaaialaarkihakarkiaahmlevnendldwevdr
    fkvkgddskfktmadiawqayhqppaglepgleavhyydppnftypfgiylcvvdidrat
    getkvrrfyalddcgtrinpmiiegqihggltegyavamgqqmpfdaqgnllgntlmdyf
    lptavetphwetdhtvtpsphhpigakgvaesphvgsiptftaavvdafahvgvthldmp
    htsyrvwkslkehnlal
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffuF (F:)
    mipprfeyhapksvgeavallgqlgsdakllagghsllpmmklrfaqpehlidinripel
    rgireegstvvigamtvendlisspivqarlpllaeaakliadpqvrnrgtiggdiahgd
    pgndhpalsiaveahfvlegpngrrtvpadgfflgtymtlleenevmveirvpafaagtg
    wayeklkrktgdwatagcavvmrksggtvshirialtnvaptalraeaaeaallgkaftk
    eavqaaadaaiaicepaedlrgdadyktamagqmvkralnaawarca