Lineage for d1ffub2 (1ffu B:147-803)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2194009Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 2194010Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (2 families) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 2194011Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 protein domains)
  6. 2194034Protein Carbon monoxide (CO) dehydrogenase molybdoprotein [56010] (2 species)
  7. 2194035Species Hydrogenophaga pseudoflava [TaxId:47421] [56012] (2 PDB entries)
  8. 2194038Domain d1ffub2: 1ffu B:147-803 [41423]
    Other proteins in same PDB: d1ffua1, d1ffua2, d1ffub1, d1ffuc1, d1ffuc2, d1ffud1, d1ffud2, d1ffue1, d1ffuf1, d1ffuf2
    complexed with cdp, fad, fes

Details for d1ffub2

PDB Entry: 1ffu (more details), 2.35 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor
PDB Compounds: (B:) cutl, molybdoprotein of carbon monoxide dehydrogenase

SCOPe Domain Sequences for d1ffub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffub2 d.133.1.1 (B:147-803) Carbon monoxide (CO) dehydrogenase molybdoprotein {Hydrogenophaga pseudoflava [TaxId: 47421]}
idalkpdapvlredlagktsgahgprehhnhiftwgagdkaatdavfanapvtvsqhmyy
prvhpcpletcgcvasfdpikgdlttyitsqaphvvrtvvsmlsgipeskvrivspdigg
gfgnkvgiypgyvcaivasivlgrpvkwvedrvenisttafardyhmdgelaatpdgkil
glrvnvvadhgafdacadptkfpaglfhicsgsydiprahcsvkgvytnkapggvayrcs
frvteavyliermvdvlaqklnmdkaeiraknfirkeqfpyttqfgfeydsgdyhtalkk
vldavdypalraeqaarradpnsptlmgiglvtftevvgagpskmcdilgvgmfdsceir
ihptgsaiarmgtitqgqghqttyaqiiatelgipseviqveegdtstapyglgtygsrs
tpvagaaialaarkihakarkiaahmlevnendldwevdrfkvkgddskfktmadiawqa
yhqppaglepgleavhyydppnftypfgiylcvvdidratgetkvrrfyalddcgtrinp
miiegqihggltegyavamgqqmpfdaqgnllgntlmdyflptavetphwetdhtvtpsp
hhpigakgvaesphvgsiptftaavvdafahvgvthldmphtsyrvwkslkehnlal

SCOPe Domain Coordinates for d1ffub2:

Click to download the PDB-style file with coordinates for d1ffub2.
(The format of our PDB-style files is described here.)

Timeline for d1ffub2: