Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.0: automated matches [191603] (1 protein) not a true family |
Protein automated matches [191100] (15 species) not a true protein |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [189092] (2 PDB entries) |
Domain d3k6eb1: 3k6e B:1-151 [179130] Other proteins in same PDB: d3k6ea2, d3k6eb2 automated match to d1yava3 complexed with po4 |
PDB Entry: 3k6e (more details), 2.81 Å
SCOPe Domain Sequences for d3k6eb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k6eb1 d.37.1.0 (B:1-151) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} miakefetfllgqeetfltpaknlavlidthnadhatlllsqmtytrvpvvtdekqfvgt iglrdimayqmehdlsqeimadtdivhmtktdvavvspdftitevlhklvdesflpvvda egifqgiitrksilkavnallhdfskeyeir
Timeline for d3k6eb1: