SCOPe 2.07: Domain d3k6eb1: 3k6e B:1-151

Lineage for d3k6eb1 (3k6e B:1-151)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.0: automated matches [191603] (1 protein)
   not a true family

6. Protein automated matches [191100] (15 species)
   not a true protein

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [189092] (2 PDB entries)

8. Domain d3k6eb1: 3k6e B:1-151 [179130]
   Other proteins in same PDB: d3k6ea2, d3k6eb2
   automated match to d1yava3
   complexed with po4

Details for d3k6eb1

PDB Entry: 3k6e, 2.81 Å

PDB Description: crystal structure of cbs domain protein from streptococcus pneumoniae tigr4

PDB Compounds: (B:) CBS domain protein

SCOPe Domain Sequences for d3k6eb1:

Sequence; same for both SEQRES and ATOM records:

>d3k6eb1 d.37.1.0 (B:1-151) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
miakefetfllgqeetfltpaknlavlidthnadhatlllsqmtytrvpvvtdekqfvgt
iglrdimayqmehdlsqeimadtdivhmtktdvavvspdftitevlhklvdesflpvvda
egifqgiitrksilkavnallhdfskeyeir

Timeline for d3k6eb1:

• d3k6eb1 first appeared in SCOPe 2.01, called d3k6eb_
  
• d3k6eb1 appears in SCOPe 2.06
  
• d3k6eb1 appears in the current release, SCOPe 2.08