Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein Hypothetical protein YkuL [117881] (1 species) |
Species Bacillus subtilis [TaxId:1423] [117882] (1 PDB entry) Uniprot O31698 9-142 |
Domain d1yava3: 1yav A:13-144 [144629] Structural genomics target complexed with so4 |
PDB Entry: 1yav (more details), 2.1 Å
SCOPe Domain Sequences for d1yava3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} eatvgqfmieadkvahvqvgnnlehallvltktgytaipvldpsyrlhgligtnmimnsi fgleriefekldqitveevmltdiprlhindpimkgfgmvinngfvcvendeqvfegift rrvvlkelnkhi
Timeline for d1yava3: