Lineage for d1yava3 (1yav A:13-144)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550319Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2550320Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2550321Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2550395Protein Hypothetical protein YkuL [117881] (1 species)
  7. 2550396Species Bacillus subtilis [TaxId:1423] [117882] (1 PDB entry)
    Uniprot O31698 9-142
  8. 2550397Domain d1yava3: 1yav A:13-144 [144629]
    Structural genomics target
    complexed with so4

Details for d1yava3

PDB Entry: 1yav (more details), 2.1 Å

PDB Description: crystal structure of cbs domain-containing protein ykul from bacillus subtilis
PDB Compounds: (A:) hypothetical protein BSU14130

SCOPe Domain Sequences for d1yava3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]}
eatvgqfmieadkvahvqvgnnlehallvltktgytaipvldpsyrlhgligtnmimnsi
fgleriefekldqitveevmltdiprlhindpimkgfgmvinngfvcvendeqvfegift
rrvvlkelnkhi

SCOPe Domain Coordinates for d1yava3:

Click to download the PDB-style file with coordinates for d1yava3.
(The format of our PDB-style files is described here.)

Timeline for d1yava3: