Lineage for d3k49e_ (3k49 E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006908Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2006909Protein automated matches [190220] (14 species)
    not a true protein
  7. 2006920Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186980] (6 PDB entries)
  8. 2006924Domain d3k49e_: 3k49 E: [179064]
    automated match to d1m8wb_
    protein/RNA complex; complexed with cit

Details for d3k49e_

PDB Entry: 3k49 (more details), 2.5 Å

PDB Description: Puf3 RNA binding domain bound to Cox17 RNA 3' UTR recognition sequence site B
PDB Compounds: (E:) mRNA-binding protein PUF3

SCOPe Domain Sequences for d3k49e_:

Sequence, based on SEQRES records: (download)

>d3k49e_ a.118.1.0 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
splleqlrnsssdknsnsnmslkdifghslefckdqhgsrfiqrelatspasekevifne
irddaielsndvfgnyviqkffefgskiqkntlvdqfkgnmkqlslqmyacrviqkaley
idsnqrielvlelsdsvlqmikdqngnhviqkaietipieklpfilssltghiyhlsths
ygcrviqrllefgssedqesilnelkdfipyliqdqygnyviqyvlqqdqftnkemvdik
qeiietvannvveyskhkfasnvveksilygsknqkdliiskilprdknhalnleddspm
ilmikdqfanyviqklvnvsegegkkliviairayldklnksnslgnrhlasveklaalv
e

Sequence, based on observed residues (ATOM records): (download)

>d3k49e_ a.118.1.0 (E:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
splleqlrnsssnmslkdifghslefckdqhgsrfiqrelatspasekevifneirddai
elsndvfgnyviqkffefgskiqkntlvdqfkgnmkqlslqmyacrviqkaleyidsnqr
ielvlelsdsvlqmikdqngnhviqkaietipieklpfilssltghiyhlsthsygcrvi
qrllefgssedqesilnelkdfipyliqdqygnyviqyvlqqdqftnkemvdikqeiiet
vannvveyskhkfasnvveksilygsknqkdliiskilprdknhalnleddspmilmikd
qfanyviqklvnvsegegkkliviairayldklnksngnrhlasveklaalve

SCOPe Domain Coordinates for d3k49e_:

Click to download the PDB-style file with coordinates for d3k49e_.
(The format of our PDB-style files is described here.)

Timeline for d3k49e_: