Lineage for d3k3ha_ (3k3h A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736712Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2737039Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species)
  7. 2737043Species Human (Homo sapiens) [TaxId:9606] [109943] (22 PDB entries)
    Uniprot O76083 241-566
  8. 2737076Domain d3k3ha_: 3k3h A: [179040]
    automated match to d2hd1a1
    complexed with bye, mg, zn

Details for d3k3ha_

PDB Entry: 3k3h (more details), 2.5 Å

PDB Description: Crystal structure of the PDE9A catalytic domain in complex with (S)-BAY73-6691
PDB Compounds: (A:) High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOPe Domain Sequences for d3k3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k3ha_ a.211.1.2 (A:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
yllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfcvhdn
yrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynntyqi
nartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlilatdm
arhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdclleeyf
mqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlqplwe
srdryeelkriddamkelqkk

SCOPe Domain Coordinates for d3k3ha_:

Click to download the PDB-style file with coordinates for d3k3ha_.
(The format of our PDB-style files is described here.)

Timeline for d3k3ha_: