SCOP 1.63: Domain d1huua_: 1huu A:

Lineage for d1huua_ (1huu A:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (2 families)
   dimer of identical subunits

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (3 proteins)

6. Protein HU protein [47735] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [47736] (2 PDB entries)

8. Domain d1huua_: 1huu A: [17897]

Details for d1huua_

PDB Entry: 1huu, 2 Å

PDB Description: dna-binding protein hu from bacillus stearothermophilus

SCOP Domain Sequences for d1huua_:

Sequence, based on SEQRES records:

>d1huua_ a.55.1.1 (A:) HU protein {Bacillus stearothermophilus}
mnktelinavaetsglskkdatkavdavfdsitealrkgdkvqligfgnfevreraarkg
rnpqtgeemeipaskvpafkpgkalkdavk

Sequence, based on observed residues (ATOM records):

>d1huua_ a.55.1.1 (A:) HU protein {Bacillus stearothermophilus}
mnktelinavaetsglskkdatkavdavfdsitealrkgdkvqligfgnfevreraarme
ipaskvpafkpgkalkdavk

Timeline for d1huua_:

• d1huua_ first appeared (with stable ids) in SCOP 1.55
  
• d1huua_ appears in SCOP 1.61
  
• d1huua_ appears in SCOP 1.65
  
• d1huua_ appears in the current release, SCOPe 2.08