Class a: All alpha proteins [46456] (179 folds) |
Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (2 families) dimer of identical subunits |
Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins) |
Protein HU protein [47735] (3 species) |
Species Bacillus stearothermophilus [TaxId:1422] [47736] (2 PDB entries) |
Domain d1huua_: 1huu A: [17897] |
PDB Entry: 1huu (more details), 2 Å
SCOP Domain Sequences for d1huua_:
Sequence, based on SEQRES records: (download)
>d1huua_ a.55.1.1 (A:) HU protein {Bacillus stearothermophilus} mnktelinavaetsglskkdatkavdavfdsitealrkgdkvqligfgnfevreraarkg rnpqtgeemeipaskvpafkpgkalkdavk
>d1huua_ a.55.1.1 (A:) HU protein {Bacillus stearothermophilus} mnktelinavaetsglskkdatkavdavfdsitealrkgdkvqligfgnfevreraarme ipaskvpafkpgkalkdavk
Timeline for d1huua_: