Lineage for d1huua_ (1huu A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4185Fold a.55: Prokaryotic DNA-bending protein [47728] (1 superfamily)
  4. 4186Superfamily a.55.1: Prokaryotic DNA-bending protein [47729] (1 family) (S)
  5. 4187Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins)
  6. 4192Protein HU protein [47735] (2 species)
  7. 4193Species Bacillus stearothermophilus [TaxId:1422] [47736] (2 PDB entries)
  8. 4194Domain d1huua_: 1huu A: [17897]

Details for d1huua_

PDB Entry: 1huu (more details), 2 Å

PDB Description: dna-binding protein hu from bacillus stearothermophilus

SCOP Domain Sequences for d1huua_:

Sequence, based on SEQRES records: (download)

>d1huua_ a.55.1.1 (A:) HU protein {Bacillus stearothermophilus}
mnktelinavaetsglskkdatkavdavfdsitealrkgdkvqligfgnfevreraarkg
rnpqtgeemeipaskvpafkpgkalkdavk

Sequence, based on observed residues (ATOM records): (download)

>d1huua_ a.55.1.1 (A:) HU protein {Bacillus stearothermophilus}
mnktelinavaetsglskkdatkavdavfdsitealrkgdkvqligfgnfevreraarme
ipaskvpafkpgkalkdavk

SCOP Domain Coordinates for d1huua_:

Click to download the PDB-style file with coordinates for d1huua_.
(The format of our PDB-style files is described here.)

Timeline for d1huua_: