| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families) ![]() |
| Family a.7.2.0: automated matches [191602] (1 protein) not a true family |
| Protein automated matches [191097] (4 species) not a true protein |
| Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [189079] (1 PDB entry) |
| Domain d3k1se_: 3k1s E: [178959] automated match to d1e2aa_ complexed with cl, mg, na |
PDB Entry: 3k1s (more details), 2.3 Å
SCOPe Domain Sequences for d3k1se_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k1se_ a.7.2.0 (E:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mmttaeqipfqlilnsgnarsfamealqfakqgkmaeadeamvkakeaineahhfqteli
qseargekteisvllihaqdhlmnaitvkelaaefidlykkleakg
Timeline for d3k1se_: