Lineage for d3k1sc_ (3k1s C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724371Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1724417Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families) (S)
  5. 1724427Family a.7.2.0: automated matches [191602] (1 protein)
    not a true family
  6. 1724428Protein automated matches [191097] (4 species)
    not a true protein
  7. 1724429Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [189079] (1 PDB entry)
  8. 1724432Domain d3k1sc_: 3k1s C: [178957]
    automated match to d1e2aa_
    complexed with cl, mg, na

Details for d3k1sc_

PDB Entry: 3k1s (more details), 2.3 Å

PDB Description: crystal structure of the pts cellobiose specific enzyme iia from bacillus anthracis
PDB Compounds: (C:) PTS system, cellobiose-specific IIA component

SCOPe Domain Sequences for d3k1sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k1sc_ a.7.2.0 (C:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
ttaeqipfqlilnsgnarsfamealqfakqgkmaeadeamvkakeaineahhfqteliqs
eargekteisvllihaqdhlmnaitvkelaaefidlykkleakg

SCOPe Domain Coordinates for d3k1sc_:

Click to download the PDB-style file with coordinates for d3k1sc_.
(The format of our PDB-style files is described here.)

Timeline for d3k1sc_: