Lineage for d1e2aa_ (1e2a A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724371Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1724417Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families) (S)
  5. 1724418Family a.7.2.1: Enzyme IIa from lactose specific PTS, IIa-lac [46974] (1 protein)
    form trimers with 9 helices in a bundle
    automatically mapped to Pfam PF02255

    this is a repeat family; one repeat unit is 2e2a A: found in domain
  6. 1724419Protein Enzyme IIa from lactose specific PTS, IIa-lac [46975] (1 species)
  7. 1724420Species Lactococcus lactis [TaxId:1358] [46976] (2 PDB entries)
  8. 1724424Domain d1e2aa_: 1e2a A: [16322]
    complexed with mg

Details for d1e2aa_

PDB Entry: 1e2a (more details), 2.3 Å

PDB Description: enzyme iia from the lactose specific pts from lactococcus lactis
PDB Compounds: (A:) enzyme iia

SCOPe Domain Sequences for d1e2aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e2aa_ a.7.2.1 (A:) Enzyme IIa from lactose specific PTS, IIa-lac {Lactococcus lactis [TaxId: 1358]}
mnreemtllgfeivayagdarskllealkaaengdfakadslvveagsciaeahssqtgm
lareasgeelpysvtmmhgqdhlmttillkdvihhlielykr

SCOPe Domain Coordinates for d1e2aa_:

Click to download the PDB-style file with coordinates for d1e2aa_.
(The format of our PDB-style files is described here.)

Timeline for d1e2aa_: