SCOPe 2.04: Domain d1e2aa_: 1e2a A:

Lineage for d1e2aa_ (1e2a A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families)

5. Family a.7.2.1: Enzyme IIa from lactose specific PTS, IIa-lac [46974] (1 protein)
   form trimers with 9 helices in a bundle
   automatically mapped to Pfam PF02255
   this is a repeat family; one repeat unit is 2e2a A: found in domain

6. Protein Enzyme IIa from lactose specific PTS, IIa-lac [46975] (1 species)

7. Species Lactococcus lactis [TaxId:1358] [46976] (2 PDB entries)

8. Domain d1e2aa_: 1e2a A: [16322]
   complexed with mg

Details for d1e2aa_

PDB Entry: 1e2a, 2.3 Å

PDB Description: enzyme iia from the lactose specific pts from lactococcus lactis

PDB Compounds: (A:) enzyme iia

SCOPe Domain Sequences for d1e2aa_:

Sequence; same for both SEQRES and ATOM records:

>d1e2aa_ a.7.2.1 (A:) Enzyme IIa from lactose specific PTS, IIa-lac {Lactococcus lactis [TaxId: 1358]}
mnreemtllgfeivayagdarskllealkaaengdfakadslvveagsciaeahssqtgm
lareasgeelpysvtmmhgqdhlmttillkdvihhlielykr

Timeline for d1e2aa_:

• d1e2aa_ first appeared (with stable ids) in SCOP 1.55
  
• d1e2aa_ appears in SCOPe 2.03
  
• d1e2aa_ appears in SCOPe 2.05
  
• d1e2aa_ appears in the current release, SCOPe 2.08