![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families) ![]() |
![]() | Family a.7.2.1: Enzyme IIa from lactose specific PTS, IIa-lac [46974] (1 protein) form trimers with 9 helices in a bundle automatically mapped to Pfam PF02255 this is a repeat family; one repeat unit is 2e2a A: found in domain |
![]() | Protein Enzyme IIa from lactose specific PTS, IIa-lac [46975] (1 species) |
![]() | Species Lactococcus lactis [TaxId:1358] [46976] (2 PDB entries) |
![]() | Domain d1e2aa_: 1e2a A: [16322] complexed with mg |
PDB Entry: 1e2a (more details), 2.3 Å
SCOPe Domain Sequences for d1e2aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e2aa_ a.7.2.1 (A:) Enzyme IIa from lactose specific PTS, IIa-lac {Lactococcus lactis [TaxId: 1358]} mnreemtllgfeivayagdarskllealkaaengdfakadslvveagsciaeahssqtgm lareasgeelpysvtmmhgqdhlmttillkdvihhlielykr
Timeline for d1e2aa_: