Lineage for d3jtcb_ (3jtc B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938555Protein automated matches [191280] (6 species)
    not a true protein
  7. 2938568Species Human (Homo sapiens) [TaxId:9606] [189896] (35 PDB entries)
  8. 2938572Domain d3jtcb_: 3jtc B: [178820]
    Other proteins in same PDB: d3jtcc_, d3jtcd_
    automated match to d1lqvb_
    complexed with ca, mg, nag, pty

Details for d3jtcb_

PDB Entry: 3jtc (more details), 1.6 Å

PDB Description: importance of mg2+ in the ca2+-dependent folding of the gamma- carboxyglutamic acid domains of vitamin k-dependent clotting and anticlotting proteins
PDB Compounds: (B:) Endothelial protein C receptor

SCOPe Domain Sequences for d3jtcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jtcb_ d.19.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartqs
glqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsfr
peralwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhisae

SCOPe Domain Coordinates for d3jtcb_:

Click to download the PDB-style file with coordinates for d3jtcb_.
(The format of our PDB-style files is described here.)

Timeline for d3jtcb_: